#herbalalami photos & videos

Loading...
2 minutes ago

Suplemen Mata Herbal by @eyevitamin_id Keunggulan Suplemennya : 1. Menghilangkan Mata Minus & Silinder pada Mata (Hasil 1-2 Minggu udah ada perubahan ) 2. Memperbaiki Kecembungan Kornea pada Mata agar kembali Normal. 3. Suplemen dengan Kandungan utama Vitamin A Tinggi , Lutein , Beta Carotene , Lechitine dan Carrot Powder yg sangat baik buat Mata. 4. 1 Kapsulnya mengandung vitamin 1 Kg vitamin Wortel. 5. Aman tanpa Efek Samping dan Ketergantungan (Sertifikat BPOM, MUI, GMP ) Cita-Cita jadi terhambat dan susah masuk pekerjaan hanya karena Minus & Silinder pada Mata? Pekerjaan dan aktivitas sering terhambat hanya karna Kacamata rusak/hilang? Nonton Film 3D jadi ribet dengan 2 Kacamata? Uda mencoba berbagai macam cara tapi tidak membuahkan hasil? Segera Konsultasikan dengan ahlinya @eyevitamin_id Contact : ✉WA :088213814203 Segera Wujudkan Impian Anda memiliki Mata normal bebas Kacamata Minus & Silinder ! 😃 #vitamin #mataminussembuh #mataminusmurah #mataminus terbaik #endorseselebgram #selebtiktok #youtube #twitter #twittereceh #vitaminmataeradigital #herbalalami #HalalLifestyle #selebgramindonesia #selebgramhijab #youtuberin #youtuberindonesia

00
7 minutes ago

Suplemen Mata Herbal by @eyevitamin_id Keunggulan Suplemennya : 1. Menghilangkan Mata Minus & Silinder pada Mata (Hasil 1-2 Minggu udah ada perubahan ) 2. Memperbaiki Kecembungan Kornea pada Mata agar kembali Normal. 3. Suplemen dengan Kandungan utama Vitamin A Tinggi , Lutein , Beta Carotene , Lechitine dan Carrot Powder yg sangat baik buat Mata. 4. 1 Kapsulnya mengandung vitamin 1 Kg vitamin Wortel. 5. Aman tanpa Efek Samping dan Ketergantungan (Sertifikat BPOM, MUI, GMP ) Cita-Cita jadi terhambat dan susah masuk pekerjaan hanya karena Minus & Silinder pada Mata? Pekerjaan dan aktivitas sering terhambat hanya karna Kacamata rusak/hilang? Nonton Film 3D jadi ribet dengan 2 Kacamata? Uda mencoba berbagai macam cara tapi tidak membuahkan hasil? Segera Konsultasikan dengan ahlinya @eyevitamin_id Contact : ✉WA :088213814203 Segera Wujudkan Impian Anda memiliki Mata normal bebas Kacamata Minus & Silinder ! 😃 #vitamin #mataminussembuh #mataminusmurah #mataminus terbaik #endorseselebgram #selebtiktok #youtube #twitter #twittereceh #vitaminmataeradigital #herbalalami #HalalLifestyle #selebgramindonesia #selebgramhijab #youtuberin #youtuberindonesia

00
9 minutes ago

Mau jadi Pusat Perhatian...? huhuyy Mau punya Body Sexy...? yea ! Mau bokong Besar...? Mau payudara Padat...? Mau payudara Montok ...? Mau payudara Besar...? . . BISAAAA BANGETTTTT !!!! Kami punya solusinya... Dengan produk Berkualitas International ... Mewujudkan semua IMPIAN ANDA!!! . . tunggu apa lagi? JANGAN MALU-MALU ! JANGAN RAGU-RAGU ! JANGAN TAKUT-TAKUT !!! . KARENA KECANTIKAN ANDA SANGAT BERHARGA !!! . Jangan sampai gara2 kurang Menarik.. kurang Sexy.. kurang Bahenol banyak hal terlewat begitu saja... perbaiki dirimu sekarang !! Untuk infonya langsung hubungi salah satu contact person dibawah ini : . . WA : 089513574699 . Salah satunya aja ya.. Makasi 😊 #dress #bossqu #herbalalami

00
17 minutes ago

Turmeric dikenal juga sebagai kunyit. Rimpang kunyit merupakan tanaman rempah-rempah asli yang populer di Asia Tenggara Kunyit memiliki efek farmakologi anti inflamasi, anti piretik serta dikenal bermanfaat meringankan gangguan lambung, mengobati radang, alergi dan mampu meningkatkan imun tubuh Herbastory Turmeric hadir dengan ekstrak kunyit asli yang diolah dengan teknologi ekstraksi suhu rendah yang higienis dan bisa juga kamu gunakan untuk memasak atau membuat kunyit asam favoritmu Iho, coba sekarang yuk! Diproduksi dari ekstrak Kunyit asli, Herbastory Turmeric hadir dengan kemasan pouch yang lebih praktis dan pastinya lebih efektif! Resep: Campuran kunyit, jahe, madu dan susu dapat mencegah virus dan aman dikonsumsi ibu menyusui #Herbastory

01
19 minutes ago

Ada yang pernah tahu daun sidaguri? Nah berikut ini beragam manfaatnya, yuk simak penjelasan pada gambar. ㅤㅤㅤㅤㅤㅤ #daunsidaguri #sidaguri #obatdiabetes #obatkolesterol #minyakbalurtradisional #antibakteri #MinyakSumberWaras #herbalalami #herbs #antioksidan #minyakatsiri #essentialoils #antioksidanalami #antiinflamasi #peredanyeri #antikanker #antimalaria

10
19 minutes ago

Kabar gembira datang dari salah satu pemakai Xtreme. Xtreme terbukti mampu membantu proses penyembuhan pemakai juga dapat mengembalikan selera makan. Xtreme sudah terbukti dan teruji secara klinis. Segera buktikan dan rasakan manfaatnya sendiri! Informasi selengkapnya mengenai produk/pemesanan dapat hubungi: 📞 : 081298090571 📧 : xtremeherbal @gmail .com • #xtreme #xtremeplus #herbal #kesehatan #imunitastubuh #cegahcovid19 #herbalalami #vitamin #suplemenherbal #drkantas #drkantasxtreme #drkantasextreme #drkantasxtremeplus #drkantasplus #drkantasextremeplus #Indonesiaharussehat

10
20 minutes ago

Kabar gembira datang dari salah satu pemakai Xtreme. Xtreme terbukti mampu membantu proses penyembuhan pemakai juga dapat mengembalikan selera makan. Xtreme sudah terbukti dan teruji secara klinis. Segera buktikan dan rasakan manfaatnya sendiri! Informasi selengkapnya mengenai produk/pemesanan dapat hubungi: 📞 : 081298090571 📧 : xtremeherbal @gmail .com • #xtreme #xtremeplus #herbal #kesehatan #imunitastubuh #cegahcovid19 #herbalalami #vitamin #suplemenherbal #drkantas #drkantasxtreme #drkantasextreme #drkantasxtremeplus #drkantasplus #drkantasextremeplus #Indonesiaharussehat

10
20 minutes ago

Kabar gembira datang dari salah satu pemakai Xtreme. Xtreme terbukti mampu membantu proses penyembuhan pemakai juga dapat mengembalikan selera makan. Xtreme sudah terbukti dan teruji secara klinis. Segera buktikan dan rasakan manfaatnya sendiri! Informasi selengkapnya mengenai produk/pemesanan dapat hubungi: 📞 : 081298090571 📧 : xtremeherbal @gmail .com • #xtreme #xtremeplus #herbal #kesehatan #imunitastubuh #cegahcovid19 #herbalalami #vitamin #suplemenherbal #drkantas #drkantasxtreme #drkantasextreme #drkantasxtremeplus #drkantasplus #drkantasextremeplus #Indonesiaharussehat

10
22 minutes ago

Jumlah kasus Covid-19 di Indonesia tentu masih tinggi. Untuk itu diperlukan tingkat kewaspadaan diri yang tinggi dalam situasi pandemi saat ini. Tetap sehat dan berstamina di situasi pandemi Covid-19 bersama XTREME. Dengan berbagai kandungan herbal yaitu: Temu Putih, Temu Lawak, Temu Kunci, dan Jintan Hitam, tentu akan memberikan Anda stamina ekstra sekaligus pencegahan infeksi virus untuk aktivitas Anda yang padat. Segera buktikan dan rasakan manfaat baiknya! Informasi selengkapnya mengenai produk/pemesanan dapat hubungi: 📞 : 081298090571 📧 : xtremeherbal @gmail .com • #xtreme #xtremeplus #herbal #kesehatan #imunitastubuh #cegahcovid19 #herbalalami #vitamin #suplemenherbal #covid19 #viruscorona #drkantas #drkantasxtreme #drkantasextreme #drkantasxtremeplus #drkantasplus #drkantasextremeplus #Indonesiaharussehat

10
23 minutes ago

Stay healthy, stay cool, with XTREME ⚡ Aktivitas yang ekstra pada situasi pandemi Covid-19 ini tentu memerlukan stamina yang ekstra juga. Stamina ekstra secara instan? XTREME jawabannya! Dengan berbagai manfaat baik, XTREME hadir dan dapat dikonsumsi untuk segala usia dengan takaran yang ditentukan. Segera buktikan dan rasakan manfaat baiknya! Informasi selengkapnya mengenai produk/pemesanan dapat hubungi: 📞 : 081298090571 📧 : xtremeherbal @gmail .com • #xtreme #xtremeplus #herbal #kesehatan #imunitastubuh #cegahcovid19 #herbalalami #vitamin #suplemenherbal #covid19 #viruscorona #drkantas #drkantasxtreme #drkantasextreme #drkantasxtremeplus #drkantasplus #drkantasextremeplus #Indonesiaharussehat

10
28 minutes ago

Pria juga perlu perawatan ya.... Ini juga salah satu sunscreen Yg bisa d pakai pria. Untuk melindungi wajahnya dari sinar matahari langsung. Karna pria sejatinya selalu berbaur dengan matahari langsung. Perlu deh pakai sunscreen spray by fabil beauty😍 #sunscreenspray #sunscreeneveryday #spray #pelindungwajah #antiradiasi #perawatanwajahpria #perawatanwajahbpomresmi #halal #herbalalami #kosmetik #ragamkecantikan #skincareman

20
36 minutes ago

🧼 TRACEMIN soap nasa🧼 Manfaat Tracemin Nasa : - Membantu Menghaluskan, membersihkan, meremajakan, mencerahkan kulit dari debu minyak dan kotoran. - Membantu Mencegah kulit rusak atau keriput sejak dini. - Membantu Mengangkat sel kulit mati dan melindungi kulit terhadap pengaruh radikal bebas. - Membantu Menjaga kelembaban kulit agar kulit tampak cerah dan tidak kusam. - Mengandung vitamin dan mineral yg dibutuhkan kulit, Mengatasi jerawat dan gangguan penyakit kulit lainnya. - Selain manfaat yang sudah di sebutkan diatas, Sabun Trace Mineral bermanfaat juga sebagai sabun anti-septik Cara Pakai : Gunakan pada saat mandi dengan cara Gosokan keseluruh tubuh kemudian bilas dengan aiir ------------------------------------------------------- Info order dll: -wa.082111979744 #herbalnasa #herbalalami #herbalbpom #herbalkecantikan #herbalkesehatan

00
41 minutes ago

TESTIMONI DAN ATURAN MINUM GASTRO HIU GASTRO HIU adalah herbal 100% alami yang diformulasikan secara khusus untuk mengatasi dan mencegah gangguan pencernaan terutama penyakit maag baik bersifat akut maupun kronis Gastrohiu berkhasiat: - Mengatasi penyakit maag akut dan kronis - Meredakan rasa perih di lambung - Meredakan sakit seperti terbakar pada perut bagian atas - Meredakan rasa mual, muntah - Mengembalikan selera makan - Mengatasi kembung dan terasa penuh pada perut bagian atas setelah makan Aturan Minum Pengobatan 3 x sehari 3 kapsul diminum sampai sembuh Untuk pengobatan optimal minum sampai 5 botol Pencegahan / pemeliharaan 2 x sehari 2 kapsul. Bagi anda yang juga mengkonsumsi obat kimia, obat herbal di minum 1-2 jam sebelum/setelah meminum obat kimia Semoga Allah Ta'ala memberikan kesembuhan Info wa.me//6285327888759 #herbalalami #jamumaag #herbalmaag #obatmaag #sakitperut #sakitlambung #maag #asamlambung #gerd #gastrohiu #herbalindoutama #obatmaaghherbal #obatmaaghalami #obatmaaghampuh #obatmaaghaman #obatmaaghmurah #obatasamlambungaman #obatasamlambungampuh #obatasamlambungalami #obatasamlambungmurah #obatasamlambungherbal #obatgerdherbal #obatgerdalami #obatgerdaman #obatgerdampuh #obatgerdmurah #obatgerd #herbalkomplit #herbalgrosir #grosirherbal

10
42 minutes ago

Buat kamu yang susah banget nurunin berat badan Wajib cob @healthy .slimfit3 selain bahan2 nya herbal alami, ini sangat ampuh banget menurunkan berat badan,1 pket saja bisa turun. 8-10 kilo lho dalam waktu 2 minggu saja TANPA OLAH RAGA & TANPA DIET KETAT , Karna bahan2 sepenuhnya herbal jadi buat,IBU MENYUSUI , laki2 dan perempuan 100% aman boleh juga buat program hamil ya .. 👇 👇 👇 🎺Custamer baru WAJIB KONSULTASI SEBELUM ORDER YA 🎺ORDER CEPAT BISA LANGSUNG KE WA YA KONSUL & ORDER WA 📞Call :083896495524 @healthy .slimfit3 #tkwtaiwan #tkwhongkong #tkwsingapur #tkwmalaysia #jakartahits #herbal #herbalalami #dietplen #herbalifebandung #herbalifejakarta #sukasayur #djkety #videolucu #lambekuliner #diet #shakeherbal #herbami #olahraga #ordernow

10
43 minutes ago

Bissmillah ---------- ---------- . . . MasyaAllah....manfaat dari VCO sangat bagus untuk tubuh ya bun.... Apalagi untuk kulit...jd lebih glowing dan halus... . . Kontak wa 👇 +85251692067 . . Follow 👉 @shietiey_zeeidaherbal Follow 👉 @shietiey_zeeidaherbal . #produkzeeida #herbalzeeida #herbaljantung #herbalalami #minyaktelonbidara #minyakkemiri #nutricly #spiriluna #Habbatusauda #maskerwajahalami #jakarta #indonesia #hongkong #herbalindonesia #jabodetabek #lampung #Habbatusauda #herbal #zeeidaherbal #obatjerawat #sabunjerawat #sabunbidara

00
47 minutes ago

Inilah testimoni dari beberapa saudara kita yang merasa terbantu oleh patchouli.mau info lebih banyak? Copy link ini ..🔻 bit.ly/solusirambutrontokasni2 bit.ly/solusirambutrontokasni2 Atau klik link di profile saya ya🙂🙏 Wa 085606058696 #essenzoessentialoil #patchouli #patchouliessentialoil #solusirambutrontok #solusiketombe #bisatumbuhlebat #solusibotak #amanalami #praktisalami #herbalalami #nikmatipraktisnya #temanhidupenak .

00
48 minutes ago

Info Promo Product . .................................................. . Info & Pemesanan Wa Admin : 0812 9868 5262 . http://www.madukukka.com . .................................................. #madu #maduasli #madumurni #madusarang #maduhutan #hidupsehatalami #dirumahaja #hidupsehat #alamiherbal #herbalalami #obatherbal #minummadusunnahnabi #sunnahnabi #madukukka #madubekasi #minummadutiaphari #lebahganteng #lebahmadu #promo #sehatalami #sehatitumahal #madukukkaasli

20
49 minutes ago

Info Promo Product . .................................................. . Info & Pemesanan Wa Admin : 0812 9868 5262 . http://www.madukukka.com . .................................................. #madu #maduasli #madumurni #madusarang #maduhutan #hidupsehatalami #dirumahaja #hidupsehat #alamiherbal #herbalalami #obatherbal #minummadusunnahnabi #sunnahnabi #madukukka #madubekasi #minummadutiaphari #lebahganteng #lebahmadu #promo #sehatalami #sehatitumahal #madukukkaasli

20
49 minutes ago

Info Promo Product . .................................................. . Info & Pemesanan Wa Admin : 0812 9868 5262 . http://www.madukukka.com . .................................................. #madu #maduasli #madumurni #madusarang #maduhutan #hidupsehatalami #dirumahaja #hidupsehat #alamiherbal #herbalalami #obatherbal #minummadusunnahnabi #sunnahnabi #madukukka #madubekasi #minummadutiaphari #lebahganteng #lebahmadu #promo #sehatalami #sehatitumahal #madukukkaasli

20
49 minutes ago

PROPOLIS HASANA terbuat dari ekstrak propolis berkualitas dengan proses sesuai standar keamanan obat tradisional Aman dikonsumsi dan memiliki banyak manfaat bagi kesehatan tubuh manusia, berupa : - Memelihara daya tahan tubuh - Mencegah darah tinggi dan jantung koroner - Baik bagi wanita hamil - Pemulih stamina - Mencegah dan mengobati penyakit kewanitaan - Meningkatkan hormon pertumbuhan pada anak #PropolisHasana #TipsSehat #Propolis #Herbal #ProdukHasbi #EkstrakPropolis #KapsulPropolis #SehatAlami #Herbal #ProdukHerbal #HerbalAlami #HerbalIndo #Diabetes #Gula #Diet #Hipertensi #DarahTinggi #Stamina #DayaTahanTubuh #Sehat #pandemi #asamurat #purin #sakit #PenyakitAsamUrat #diRumahAja

00
49 minutes ago

HASANA PEGAGAN terbuat dari ekstrak pegagan berkualitas dengan proses sesuai standar keamanan obat tradisional Berkhasiat untuk meningkatkan kinerja dan kesehatan otak agar terhindar dari penyakit berbahaya seperti stroke. Beberapa manfaat lainnya berupa : - Mencegah penyempitan pembuluh darah (penyebab utama stroke ) - Melancarkan sistem peredaran darah - Meningkatkan daya ingat - Mencegah Alzheimer (penurunan kemampuan berfikir dan berbicara ) - Meningkatkan konsentrasi - Anti peradangan (anti inflamasi ) #HasanaPegagan #TipsSehat #ProdukHasbi #Herbal #Pegagan #EkstrakDaunPegagan #EkstrakPegagan #KapsulDaunPegagan #KapsulPegagan #SehatAlami #ProdukHerbal #HerbalAlami #HerbalIndo #DaunPegagan #Hipertensi #Brain #dirumahaja #otak #azheimer

00
49 minutes ago

HASANA MO LIFE terbuat dari ekstrak daun kelor berkualitas dengan proses sesuai standar keamanan obat tradisional Memiliki banyak manfaat bagi kesehatan tubuh yang sudah digunakan secara turun temurun, berupa : - Menjaga kesehatan mata - Mengobati katarak - Mengatasi pegal linu dan rematik - Mengobati cacingan - Penyembuhan herpes dan luka bernanah - Anti diabetes - Anti kanker #HasanaMoLife #Kelor #Herbal #TipsSehat #Protein #ProdukHasbi #EkstrakDaunKelor #KapsulDaunKelor #KapsulKelor #EkstrakKelor #SehatAlami #ProdukHerbal #HerbalAlami #HerbalIndo #Sehat #Superfood #Mata #VitaminA #VitaminB #VitaminC #Kalsium #Diabetes #Anemia #DaunKelor #TekananDarah #diRumahAja

00
49 minutes ago

Info Promo Product . .................................................. . Info & Pemesanan Wa Admin : 0812 9868 5262 . http://www.madukukka.com . .................................................. #madu #maduasli #madumurni #madusarang #maduhutan #hidupsehatalami #dirumahaja #hidupsehat #alamiherbal #herbalalami #obatherbal #minummadusunnahnabi #sunnahnabi #madukukka #madubekasi #minummadutiaphari #lebahganteng #lebahmadu #promo #sehatalami #sehatitumahal #madukukkaasli

20
1 hour ago

Klik link di bio #herbal #obatherbal #herbalalami #dietsehat

00
1 hour ago

Jangan lupa minum 2 sloki sebelum tidur, agar badan tetap vit dan sehat... . Harga : 180k Netto : 380ml . #ummifa_mbiopro #herbal #herbalprobiotik #probiotik #bakteribaik #sehat #solusisehat #herbalalami #jagadayatahantubuh

20
1 hour ago

Di saat sistem pertahanan tubuh sedang melemah, disarankan untuk melakukan antisipasi agar kuman penyakit tidak berkembang. Untuk itu, penting sekali mengenali tanda-tanda daya tahan tubuh yang sedang melemah. Mari kita simak beberapa penyebab daya tahan tubuh lemah yang paling umum dialami seseorang: 1. Stres Hampir semua dari kita pernah merasakan efek stres di beberapa titik dalam hidup kita. Sakit kepala, rasa sakit di dada, rasa gelisah, dan perasaan tegang secara keseluruhan merupakan tanda stres. 2. Tidak cukup berolahraga Sistem kekebalan tubuh kita kemungkinan tidak akan menjadi yang terbaik jika gaya hidup kita terlalu berpindah-pindah. Sebagai contoh betapa pentingnya menjadi aktif, penelitian medis menunjukkan bahwa olahraga teratur dapat membantu fungsi neutrofil, yaitu jenis sel yang bekerja untuk membunuh mikroorganisme yang tidak diinginkan dan kadang-kadang berbahaya yang dapat berdampak negatif terhadap kesehatan. 3. Kurang tidur Kita mungkin tidak menyadarinya, ketika sedang tidur sel-sel dalam darah bekerja melawan infeksi. Jadi, kurang tidur bisa menyebabkan badan drop. 4. Nutrisi yang tidak benar Pola makan yang buruk, terutama ketika dikombinasikan dengan kurangnya olahraga menyebabkan daya tahan tubuh lemah. Penting untuk makan berbagai makanan yang seimbang termasuk buah-buahan, sayuran, dan sumber gandum utuh yang membantu mendukung sistem kekebalan tubuh dengan menyediakan vitamin, mineral, fitokimia dan antioksidan yang sangat penting. Itu tadi beberapa uraian mengenai penyebab daya tahan tubuh kita melemah. Semoga bermanfaat dan tetap jaga kesehatan 🙏☺️ Whatsapp : CS1 082115026741 CS2 082118073472 Website Official : www.saribunga.co.id Shopee : @rumahmaduasli Tokopedia : @rumahmaduasli Bukalapak : @saribungastore Facebook : @Saribunga Alam Lestari Offline Store : Jl. Gegerkalong Hilir No 40 Bandung 40153 #saribunga #diracikalami #disajikanasli #hijrahsehat #madualami #maduasli #promo #gratisongkir #herbalsaribunga #herbalalami #antioksidan #pandemi #madusehat #maduindonesia #ceritasaribunga

00
1 hour ago

Jangan lupa minum 2 sloki sebelum tidur, agar badan tetap vit dan sehat... . Harga : 180k Netto : 380ml . #ummifa_mbiopro #herbal #herbalprobiotik #probiotik #bakteribaik #sehat #solusisehat #herbalalami #jagadayatahantubuh

20
1 hour ago

Jangan lupa minum 2 sloki sebelum tidur, agar badan tetap vit dan sehat... . Harga : 180k Netto : 380ml . #ummifa_mbiopro #herbal #herbalprobiotik #probiotik #bakteribaik #sehat #solusisehat #herbalalami #jagadayatahantubuh

20

Top photos & videos on #herbalalami

4 weeks ago

Pernah ngebayangin ngga sih meskipun umur udah 30 tahunan, tapi kulit tetep sehat terpelihara? Itu cita-citaku banget sih dari dulu. Untung ada Nutrafor White Beauty dari @whitebeautyid yg bisa membuat kulitku jadi lembab, halus, cerah, bebas kerutan dan flek hitam. Bye bye kulit kusam dan flek hitam 👋🏼 Dan ternyata selain untuk kesehatan kulit, bisa membantu meningkatkan daya tahan tubuh juga loh biar gak gampang sakit apalagi ditengah kondisi Covid skrg ini ❤️ Langsung deh realisasikan kulit impian kamu dengan @whitebeautyid , beli skrg juga di apotek atau e-commerce/online shop fav kamu yaaa.. #nutraforwhitebeauty #suplemenkulit #antiaging #antioksidan #collactive #herbalalami #multivitamin #kulitsehat #bebaskerutan

1.0k35
3 weeks ago

Bismillah.. Sejak adanya pandemi virus covid-19 ini jadi semakin banyak orang yang lebih aware sama kesehatan diri sendiri dan keluarganya. . . Dan salah satu upaya aku sekeluarga untuk menjaga kesehatan tubuh itu, setiap pagi aku jadi rutin minum jamu atau kadang membuat minuman dari rempah rempah pakai resep JSR ( Jurus Sehat Rasulullah ) pas lagi rajin si tapi hehe.. . Ada kalanya kadang bangun kesiangan keduluan anak, alhasil ga sempet bikin jamu ( bolos ) untuk diminum hari itu.. Tapi sekarang aku udah ga khawatir lagi kalo bangun kesiangan, karena dirumah sudah ada jamu jamnas dari @jamujamnas . Alhamdulillah aku jadi punya cara simpel untuk bisa minum jamu setiap hari.. karena tinggal seduh aja, tanpa perlu merebus atau meracik rempah-rempah terlebih dahulu.. . Kalian cukup ambil 2 sdm jamu jamnas dan diseduh dengan air matang 150ml.. Oh iya.. Jamu jamnas ini aman dikonsumsi lho, karena : 1. Bahan yang digunakan adalah bahan alami dan tidak mengandung Bahan Kimia Obat (BKO ). 2. Sudah terdaftar di BADAN POM dengan nomor DINKES P-IRT NO. 2133271010994-25. 3. Yang paling penting, sudah terdaftar di LPPOM MUI dengan nomor 00130098630919 sehingga halal untuk dikonsumsi.. 4. Dan Pabrik yang mengelola jamu jamnas ini juga sudah memenuhi standar GMP (Good Manufacturing Practice ) dari cara pengelolaan dan pengemasannya sangat higiensi. . Jadii untuk kalian yang mau minum juga, ga perlu khawatir lagi.. Minum jamu kini jadi lebih praktis karena sudah dikemas dalam bentuk toples kecil yang sangat mudah sahabat bawa kemana-mana, mau buat temen naik gunung, mau buat dibawa jalan-jalan keluar kota bisa banget deh.. . Bagi kalian yang mau coba, bisa langsung cek ke akun instagram @jamujamnas .. Jangan lupa follow akunnya juga yaa.. Karena disana banyak postingan bermanfaat buat menambah pengetahuan kita tentang kesehatan.. . #jamujamnas #emponempon #herbalist #herbal #herbalalami #obatherbal #produkherbal #jamuperkasa #jamusehat #jamuindonesia #jamumurah #jamuherbal #temulawak #jamu #pedulisehat #pedulikeluarga #jagakesehatan #minumjamu #sehat

14423
last month

Jaga kesehatan ya sahabat jangan sampe telat makan, pasti diantara sahabat ada yang sering kena penyakit maag, akibat pola makan yang tidak teratur. Sakit maag atau dispepsia adalah kumpulan gejala berupa rasa nyeri, kembung, sensasi panas, dan penuh pada area perut atas. Kondisi ini terjadi akibat peningkatan jumlah asam lambung yang menimbulkan iritasi pada dinding lambung. ⁣ ⁣ Timbulnya keluhan ini dapat dipengaruhi oleh gaya hidup, seperti kebiasaan telat makan, makan terlalu cepat atau terlalu banyak, sering mengonsumsi makanan pedas, berlemak, atau berminyak, serta kebiasaan merokok dan terlalu banyak mengonsumsi minuman berkafein, beralkohol, atau bersoda.⁣ ⁣ Tapi gak cuma itu, munculnya maag juga sering dikaitkan dengan stres. Berdasarkan hasil survei penelitian, sebagian besar orang yang mengalami sakit maag mengatakan bahwa stres merupakan pemicu utamanya.⁣ ⁣ Meski begitu, hingga kini, masih belum diketahui bagaimana stres bisa memengaruhi penyakit asam lambung.⁣ ⁣ Sejauh ini, penelitian hanya menemukan bahwa orang yang sedang stres bisa lebih sensitif terhadap gejala fisik yang dialami akibat naiknya asam lambung.⁣ ⁣ Selain itu, stres juga bisa menurunkan kadar prostaglandin, yaitu zat yang bertugas untuk memperkuat lapisan mukosa lambung dan melindunginya dari asam lambung.⁣ ⁣ Maka dari itu, gak ada salahnya untuk mengendalikan stres yang dapat memengaruhi risiko terjadinya penyakit asam lambung.⁣ ⁣ Caranya, sahabat bisa lakukan teknik-teknik relaksasi, seperti latihan pernapasan, meditasi, ataupun yoga. sahabat juga dianjurkan untuk bertukar pikiran dengan orang-orang terdekat, untuk meredakan stres.⁣ ⁣ sahabat juga bisa mengonsumsi obat jenis antasida untuk mengatasi gejala penyakit asam lambung yang kamu rasakan. Sebelum mengonsumsinya, pastikan sahabat memperhatikan instruksi dan anjuran yang tertera pada kemasan, ya!⁣ Jadi kalau sahabat minum jamu jamnas yang mengandung kunyit, akan sangat bagus buat lambung sahabat, apalagi yang kerjanya sibuk seharian sampe lupa makan. yuk langsung dibuktikan saja, beli jamunya, Untuk Order Sahabat Bisa Langsung WA 0821-1781-3330 🔍Alodokter #jamujamnas #jamutradisional #emponempon #herbalalami

2452
last month

Tahu gak sih bun, kenapa si kecil suka banget sama madu syamil? karena si kecil berasa bukan sedang minum obat, tapi berasa makan permen yang biasa dia jajan di warung, dengan si kecil minum madu syamil yang manis menyehatkan pula, bunda tak usah khawatir lagi, bunda senang si kecil riang. Ayo bun stok madu syamil sebanyak-banyaknya di rumah, mumpung masih ada promo nih 9.9 hingga 30 september loh, bunda tahu banget kan selagi si kecil lagi masa tumbuh kembang, Bunda harus banget memberikan si kecil asupan gizi & vitamin terbaik. Nah semua kebaikan madu, dan herbal lainnya Insya Allah akan mecukupi kebutuhan si kecil. sehingga si kecil tumbuh dan berkembang menjadi anak yang cerdas dan aktif. Oya Bun, Madu Syamil baik dikonsumsi sebelum makan. Apalagi dalam satu sendoknya mengandung Vitamin A, B2, B5, B6 yang bertugas membantu pertumbuhan, memproduksi hormon dan sel-sel darah merah serta mengatur fungsi kekebalan tubuh Si Kecil. Kalau Si Kecil berusia 2 tahun, Bunda bisa kasih satu sendok teh makan 2x sehari. Jika Si Kecil berusia diatas 3 tahun baru deh, Bunda bisa menambah waktu minumnya menjadi 3x sehari. Buat bunda yang sudah kehabisan stok madu syamilnya, Bunda bisa langsung pesan via WA juga 0877-6329-1049 #duniaanak #ceritaanak #maduanak #maduanaksehat #maduanakpintar #maduanakkecil #madupenggemukbadananak #madugemukanak #maduasli #madumurni #madualami #maduanak #madusehat #maduherbal #maduoriginal #herbal #herbalalami #obatherbal #produkherbal #madusyamilanak

3436
5 weeks ago

Tinggal didaerah tropis seperti Indonesia ini kudu waspada lho! Apalagi masuk musim hujan, wih pasti nyamuk sangat mengganggu. Tapi, jangan sampai asal menggunakan pengusir nyamuk yaa. Yuk, kita gunakan bahan-bahan yang ada di alam. Dengan pengusir nyamuk alami, akan membantu relaksasi, anti nyamuk, dan pastinya membantu mudah tidur. Kenalan dulu sama 5 bahan alami yang mampu mengusir nyamuk dan serangga lain. Mari~ #essentialoils101 #antinyamuk #essenyialoil #bonnelsid #cegahdbd #cegahmalaria #pengusirnyamuk #pencegahnyamuk #gatalnyamuk #bugsaways   #antinyamukherbal   #seranggawefm   #herbalalami   #obatalami   #hadiahbayi   #kadobayimurah   #bayilucuibupintar   #bayilucukids   #anakpinter

15026
4 weeks ago

Assalamu'alaikum Bunda. Semangat siang. Jika suatu bangsa ingin menjadi bangsa yang maju, maka sejak dini generasinya harus terbiasa dengan budaya membaca, bahkan wahyu pertama yang Allah turunkan kepada Nabi Shalallaahu 'Alayhi Wasallam melalui malaikat Jibril adalah ayat suci Al-Qur'an yang Berbunyi Iqro (Bacalah ). Yuk Bun tanamkan kegemaran membaca si kecil sejak dini, berikut hal yang perlu bunda lakukan sejak dini, agar si kecil gemar membaca : 1. Membacakan kisah orang sholeh menjelang tidur Bunda bisa ceritakian kisah nabi atau orang soleh lainnya, jadi tidak hanya menceritakan dongeng tertentu tapi kisah orang sholeh agar sekaligus menanamkan ahlak baik kepada anak sejak dini. 2. Bacalah buku di depan anak-anak. Karena orangtua adalah contoh bagi anak-anaknya, jadi bunda harus contohkan yang baik pula ya kepada anak. agar si kecil menjadikan bunda sebagai panutan. 3. Memberikan hadiah kepada anak dengan buku Bunda bisa memberikan si kecil hadiah berupa buku bacaan, baik itu kisah islami, atau dongeng tentang orang baik. agar minat si kecil terhadap membaca terus meningkat. 4. Beri tahu manfaat membaca Menjelaskan kepada anak-anak betapa pentingnya membaca dengan tujuan membantu kehidupannya. Karena seorang yang hobi membaca bisa memperoleh manfaat dalam kehidupan. 5. Ajak anak mengunjungi perpustakaan Bunda dapat membantu si kecil untuk mengekspos buku di perpustakaan dengan membacakan cerita. Gunakan hari Sabtu dan Minggu untuk melakukan kegiatan rekreasi ke perpustakaan atau toko buku. agar si kecil bisa memilih buku kesukaannya. Oke bun segitu aja tips untuk kali ini, semoga bermanfaat ya! jangan lupa sedia selalu madu syamil di rumah, biar si kecil #GakGampangSakit untuk pemesanan bunda bisa klik link di bio ya, atau WA 0877-6329-1049 #duniaanak #ceritaanak #maduanak #maduanaksehat #maduanakpintar #maduanakkecil #madupenggemukbadananak #madugemukanak #maduasli #madumurni #madualami #maduanak #madusehat #maduherbal #maduoriginal #herbal #herbalalami #obatherbal #produkherbal #madusyamilanak

27311
4 weeks ago

Minuman Cuma Lembaja Cuka Apel Lemon Bawang Putih Lanang dan Jahe JUS NYONYA SETROONG Uji Nutrisi semoga hasilnya baik dan bermanfaat buat semuanya ya... Biar ga ragu ragu lagi konsumsi JUS NYONYA SETROONG CUMA LEMBAJA Minuman Rempah Yang Bikin Sehat. Karna Terbuat dari Cuka Apel Madu Lemon Bawang Lanang Jahe Merah.. *Dinkes P-IRT No.113337601611-22* *HALAL no. 15120037720519* Isi 350ml #dietsehatalami #dietsehatalamitanpaefecsampingyangmerugikan #dietsehatalamitanpaefeksamping #dietsehatalamitanpaefecsampingyangmerugikann #dietsehatalamisolo #dietsehatalaminasa #diettanpamenyiksa #dietsehatalamidancepatmenurunkanberatbadan #herbalalami #dietsehatalamitanpaefeksampingyangmerugikan #dietsehatalamitanpaefecsamping #dietsehatalamidenganbuah #dietsehatalamilen

1340
last month

Assalamu'alaikum Bunda. Sebelum si kecil memulai beraktifitas, yuk biasakan minum madu syamil dulu, agar kebutuhan nutrisi dan vitamin si kecil terpenuhi, atau madu syamil juga bisa sebagai pendamping menu sarapan si kecil loh. Misalkan si kecil sarapannya dengan roti, bunda bisa ganti selainya deh dengan madu syamil, biar si kecil lebih bertenaga dalam menjalankan aktifitasnya sehari-hari, kalaupun sarapannya dengan nasi, bunda bisa beri minum madu syamil terlebih dahulu ya, baru deh sarapan. Kenapa sih kak admin, harus memulai aktifitas dengan madu syamil terlebih dahulu? karena didalam madu syamil terdapat banyak kandungan bahan herbal dan vitamin, serta nutrisi yang sangat baik untuk daya tahan tubuh diantaranya: -Madu berkualitas dan di uji berkala di Laboratorium -Sari Kurma pilihan, Minyak Zaitun dan perasan pertama -Habbatussauda habbasy, dan Propolis terbaik di kelasnya -Ekstrak Curcuma berkualitas, Multi Vitamin lengkap A, B, C, D dan E, Omega 3,6 dan 9, dan Kalsium Gimana lengkap kan bun? yuk biasakan si kecil konsumsi madu syamil setiap hari, agar si kecil tumbuh menjadi orang yang sehat dan cerdas. Pasti Bunda bertanya-tanya kan, aturan pakainya gimana sih kak admin? -Kocok terlebih dahulu sebelum minum -Madu Syamil ini akan sangat baik jika diminum Sebelum makan -Usia dibawah 2 tahun: 1/2 / 1 sendok teh 2x sehari. -Usia 2-3 tahun: 2 sendok teh 2x sehari. -Usia 4-12 tahun: 1 sendok makan 3x sehari oya buat bunda yang sudah kehabisan stok madu syamilnya, bisa langsung pesan via WA 0877-6329-1049 atau bisa klik langsung link di bio ya bun. #duniaanak #ceritaanak #maduanak #maduanaksehat #maduanakpintar #maduanakkecil #madupenggemukbadananak #madugemukanak #maduasli #madumurni #madualami #maduanak #madusehat #maduherbal #maduoriginal #herbal #herbalalami #obatherbal #produkherbal #madusyamilanak

30012